Pay in 4 interest-free payments of $31.50 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
Specificity: DEPTOR Antibody detects endogenous levels of total DEPTOR
Androgen receptor-associated protein 54
AA Sequence: MEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNt VSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Catalogue Numbers: BS78250-50
ACT-2Entrez Gene (Mouse): 20303SwissProt (Mouse): P14097Detection Method: Colorimetric
Human INSR (Insulin Receptor) CLIA Kit - E-CL-H0368 Creative BioMart Specificity: DEPTOR Antibody detects endogenousHuman INSR (Insulin Receptor) CLIA Kit Sizes: 24T, 48T, 96T Catalogue Numbers: E CL H0368 24T, E CL H0368 48T, E CL H0368 96T Citations, Manuals and MSDS Available upon request. Abbreviation: INSR UNIProt ID: P06213 Target Synonyms: IR; CD220; HHF5; Research Areas: Cancer, Cardiovascular, Metabolism, Neuroscience, Signal transduction Target Species: Human Application: CLIA Usage: This ELISA kit applies to the in vitro quantitative determination of
US$ 341.50
US$ 164.50
US$ 109.50
US$ 299.50
US$ 299.50
US$ 29.19